PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G557300.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 674aa    MW: 75055.9 Da    PI: 6.0777
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G557300.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.21.7e-28354404252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Sevir.9G557300.6.p 354 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 404
                         799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.006343424IPR003035RWP-RK domain
PfamPF020423.0E-26356404IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2404.6E-24572656No hitNo description
SuperFamilySSF542778.34E-22573655No hitNo description
PROSITE profilePS5174522.045575658IPR000270PB1 domain
SMARTSM006665.4E-22575658IPR000270PB1 domain
PfamPF005641.1E-15576656IPR000270PB1 domain
CDDcd064076.35E-41576657No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MPLGRDVLLP GTPIPEEVDL RSTDVSSDPH ANVSLNVADT SYRAIVPEII DVLRTVCERH  60
ELPLAQTWIP CICQAKRGSR HSDEKFKYCV STVDEACYIR DPNVTGFHQA CSDHHLFRGE  120
GVVGRAFGTN EPCFATDVTA YSKAQYPLSH HAKLFNLKAA VAIRLRSIRT GSLDYVLEFF  180
LPVDCIESEE QRAMLNSLSI TIQQTCYTLR VVSLKELVDE GSFETSTVTP AEFYEKPIHE  240
NLDEVCSNIE VPVRTTSLET SEEVTSWIAS LVDAQSKGVK EMDGDLPFGF SKQEDEGFSV  300
TAGWHTPPVL GPKGTIFSGF KHHEEYEVKE PICSRHPSPS NLDKTVEKRR TKMEKTVSLE  360
ELRKHFAGSL KEAAKNLGVC PTTLKRICRQ HGINRWPSRK IKKVGHSLKK LQMVIDSVHG  420
AEGTVQLSSL YENFTKTTWS ERELQGDGTY PLSEQKGHLE PSVPDRQCEG RFTSHTSGSN  480
SMSPSCSQSS NSSHGCSSGS KSQQNGSAPQ LAVKQEVFME ENQSSTLLKA ASHAELQMFT  540
EERPVTLPRS ESQMLLSELK PVENMSGMQK SKPESLKIKA MYGEERCIFR LQPSWGFEKL  600
KEEIVKRFSI GQEMYVDLKY LDDESEWVLL TCDADLLECI DVYKSSSAQT VRILVNANVQ  660
PVLGPSFGQT GLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698188.10.0PREDICTED: protein NLP1-like isoform X1
RefseqXP_012698189.10.0PREDICTED: protein NLP1-like isoform X1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLK4A5H90.0K4A5H9_SETIT; Uncharacterized protein
STRINGSi034133m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-139Nin-like family protein